General Information

  • ID:  hor006331
  • Uniprot ID:  Q9MYK8
  • Protein name:  Relaxin A chain
  • Gene name:  RLN
  • Organism:  Felis catus (Cat) (Felis silvestris catus)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  Expressed by the placenta. Exclusively detected in cells located in the lamellar placental labyrinth and absent from other placental and non-placental uterine parts.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Felis (genus), Felinae (subfamily), Felidae (family), Feliformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SDYIRYSDRCCNVGCTRKELADLC
  • Length:  24(157-180)
  • Propeptide:  MLRLFLSHLLGVWLLLSLRARKIPAQEEVLKACGREFVRLQIRICGSLSWGKSSQQHREPRQAPAALPEIVSSSITSGAEALNGMLEYIPDLPQELKATLSEREPSFRELQPSLKDSNLNLEEVEKSILGRQNEAEDQSLSQLGRSRLDAHSRIKRSDYIRYSDRCCNVGCTRKELADLC
  • Signal peptide:  MLRLFLSHLLGVWLLLSLRARKIPA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP1, RXFP2
  • Target Unid:  A0A5F5Y6R6, A0A337SCV4
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-Q9MYK8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006331_AF2.pdbhor006331_ESM.pdb

Physical Information

Mass: 319459 Formula: C113H183N35O39S4
Absent amino acids: FHMPQW Common amino acids: C
pI: 6.21 Basic residues: 4
Polar residues: 11 Hydrophobic residues: 5
Hydrophobicity: -50.42 Boman Index: -7290
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 65
Instability Index: 980.83 Extinction Coefficient cystines: 3230
Absorbance 280nm: 140.43

Literature

  • PubMed ID:  9915995
  • Title:  Nucleic acid sequence of feline preprorelaxin and its localization within the feline placenta.